GLP-1 (7-36) acid (human, mouse, rat, porcine, bovine)

GLP-1 (7-36) acid (human, mouse, rat, porcine, bovine)
Artikelnummer
CAY41250-5
Verpackungseinheit
5 mg
Hersteller
Cayman Chemical

Verfügbarkeit: wird geladen...
Preis wird geladen...
Shelf life (days): 1460.0

Formulation: A solid

Formal Name: L-histidyl-L-alanyl-L-a-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-a-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-a-glutamylglycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-a-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysylglycyl-L-arginine, monoacetate

Amino Acids: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-OH

Purity: ≥98%

Formula Markup: C149H225N39O46 / C2H4O2

Formula Weight: 3358.7

Notes: Glucagon-like peptide 1 (GLP-1) (7-36) acid is a derivative of the hormone and GLP-1 receptor (GLP-1R) agonist GLP-1 (7-36) amide.{72462,72463} It enhances insulin-induced phosphorylation of Akt in 3T3-L1 adipocytes when used at a concentration of 100 nM in the presence of a dipeptidyl peptidase 4 (DPP-4) inhibitor.{72463} GLP-1 (7-36) acid (150 µg/kg) reduces plasma levels of total cholesterol, triglycerides, free fatty acids, LDL, insulin, and leptin, as well as adipose tissue weight, in a mouse model of obesity induced by a high-fat diet. It decreases blood glucose levels, food intake, and gastric emptying in non-obese and ob/ob mice when administered at a dose of 3 mg/kg.{72462}
Mehr Informationen
Artikelnummer CAY41250-5
Hersteller Cayman Chemical
Hersteller Artikelnummer 41250-5
Verpackungseinheit 5 mg
Mengeneinheit STK
Produktinformation (PDF) Download
MSDS (PDF) Download