GLRX Antibody - N-terminal region : FITC

GLRX Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54626_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GLRX has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. It reduces low molecular weight disulfides and proteins.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GLRX

Key Reference: Prinarakis,E., (2008) EMBO J. 27 (6), 865-875

Molecular Weight: 12kDa

Peptide Sequence: Synthetic peptide located within the following region: IKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glutaredoxin-1

Protein Size: 106

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54626_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54626_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2745
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×