Glrx1 Antibody - middle region : HRP

Glrx1 Antibody - middle region : HRP
Artikelnummer
AVIARP54625_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Glrx1 catalyzes the deglutathionylation of protein-SS-glutathione mixed disulfides.

Molecular Weight: 11kDa

Peptide Sequence: Synthetic peptide located within the following region: QEILSQLPFKRGLLEFVDITATNNTNAIQDYLQQLTGARTVPRVFIGKDC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Glutaredoxin-1

Protein Size: 107

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54625_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54625_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 64045
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×