GLRX2 Antibody - middle region : FITC

GLRX2 Antibody - middle region : FITC
Artikelnummer
AVIARP57792_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GLRX2 is a glutathione-dependent oxidoreductase that facilitates the maintenance of mitochondrial redox homeostasis upon induction of apoptosis by oxidative stress.GLRX2 is involved in response to hydrogen peroxide and regulation of apoptosis caused by oxidative stress.GLRX2 acts as a very efficient catalyst of monothiol reactions because of its high affinity for protein glutathione-mixed disulfides.GLRX2 can receive electrons not only from glutathione (GSH), but also from thioredoxin reductase supporting both monothiol and dithiol reactions.GLRX2 efficiently catalyzes both glutathionylation and deglutathionylation of mitochondrial complex I, which in turn regulates the superoxide production by the complex. Overexpression of GLRX2 decreases the susceptibility to apoptosis and prevents loss of cardiolipin and cytochrome c release.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GLRX2

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: NVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glutaredoxin-2, mitochondrial

Protein Size: 164

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57792_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57792_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51022
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×