GLRX5 Antibody - middle region : HRP

GLRX5 Antibody - middle region : HRP
Artikelnummer
AVIARP56908_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Defects in GLRX5 are the cause of anemia sideroblastic pyridoxine-refractory autosomal recessive (PRARSA). The specific function of GLRX5 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GLRX5

Key Reference: Camaschella,C., (2007) Blood 110 (4), 1353-1358

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: NAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Glutaredoxin-related protein 5, mitochondrial

Protein Size: 157

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56908_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56908_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51218
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×