GLS Antibody - C-terminal region : Biotin

GLS Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP55098_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Sahai (1983) [PubMed 6825316] demonstrated phosphate-activated glutaminase (EC 3.5.1.2) in human platelets. It is the major enzyme yielding glutamate from glutamine. Significance of the enzyme derives from its possible implication in behavior disturbances

Immunogen: The immunogen is a synthetic peptide directed towards the c terminal region of human GLS

Key Reference: Sahai (1983) [PubMed 6825316]

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glutaminase kidney isoform, mitochondrial

Protein Size: 669

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55098_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55098_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2744
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×