GLS Antibody - C-terminal region : HRP

GLS Antibody - C-terminal region : HRP
Artikelnummer
AVIARP55098_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Sahai (1983) [PubMed 6825316] demonstrated phosphate-activated glutaminase (EC 3.5.1.2) in human platelets. It is the major enzyme yielding glutamate from glutamine. Significance of the enzyme derives from its possible implication in behavior disturbances

Immunogen: The immunogen is a synthetic peptide directed towards the c terminal region of human GLS

Key Reference: Sahai (1983) [PubMed 6825316]

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Glutaminase kidney isoform, mitochondrial

Protein Size: 669

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55098_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55098_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2744
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×