GNA12 Antibody - middle region : FITC

GNA12 Antibody - middle region : FITC
Artikelnummer
AVIARP54813_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GNA12 belongs to the G-alpha family. G(12) subfamily. Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GNA12

Key Reference: Jeske,Y.W., (2008) Clin. Exp. Pharmacol. Physiol. 35 (4), 380-385

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: TFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein subunit alpha-12

Protein Size: 381

Purification: Affinity Purified

Subunit: alpha-12
Mehr Informationen
Artikelnummer AVIARP54813_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54813_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2768
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×