GNA12 Antibody - middle region : HRP

GNA12 Antibody - middle region : HRP
Artikelnummer
AVIARP54813_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: GNA12 belongs to the G-alpha family. G(12) subfamily. Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GNA12

Key Reference: Jeske,Y.W., (2008) Clin. Exp. Pharmacol. Physiol. 35 (4), 380-385

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: TFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Guanine nucleotide-binding protein subunit alpha-12

Protein Size: 381

Purification: Affinity Purified

Subunit: alpha-12
Mehr Informationen
Artikelnummer AVIARP54813_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54813_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2768
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×