GNAI2 Antibody - middle region : HRP

GNAI2 Antibody - middle region : HRP
Artikelnummer
AVIARP54631_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(i) proteins are involved in hormonal regulation of adenylate cyclase: they inhibit the cyclase in response to beta-adrenergic stimuli.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GNAI2

Key Reference: Sullivan,K.A., J. Cell. Sci. 120 (PT 13), 2171-2178 (2007)

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: EYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Guanine nucleotide-binding protein G(i) subunit alpha-2

Protein Size: 354

Purification: Affinity Purified

Subunit: alpha-2
Mehr Informationen
Artikelnummer AVIARP54631_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54631_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2771
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×