GNAQ Antibody - N-terminal region : FITC

GNAQ Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54635_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GTP for GDP bound to the inactive G p

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNAQ

Key Reference: Zapf,J., (2008) Am. J. Hum. Genet. 82 (6), 1270-1280

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein G(q) subunit alpha

Protein Size: 359

Purification: Affinity Purified

Subunit: alpha
Mehr Informationen
Artikelnummer AVIARP54635_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54635_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2776
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×