GNB1 Antibody - N-terminal region : HRP

GNB1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54637_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. GNB1 is a bet

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNB1

Key Reference: Ueda,H., (2008) J. Biol. Chem. 283 (4), 1946-1953

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1

Protein Size: 340

Purification: Affinity Purified

Subunit: beta-1
Mehr Informationen
Artikelnummer AVIARP54637_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54637_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2782
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×