GNB4 Antibody - middle region : FITC

GNB4 Antibody - middle region : FITC
Artikelnummer
AVIARP57549_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GNB4

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: DGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein subunit beta-4

Protein Size: 340

Purification: Affinity Purified

Specificity#: Gene Symbol:GNB1,GNB2,GNB3
Protein Accession#:NP_002065,NP_005264,NP_002066
Nucleotide Accession#:NM_002074,NM_005273,NM_002075
Swissprot ID:P62873,P62879,P16520


Subunit: beta1-4
Mehr Informationen
Artikelnummer AVIARP57549_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57549_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 59345
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×