Gnl1 Antibody - C-terminal region : Biotin

Gnl1 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP54748_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Gnl1 is a putative GTP binding protein; mouse and human homologs are localized to the MHC class I region.

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: EPYTSVGYLACRIPVQALLHLRHPEAEDPSAEHPWCAWDVCEAWAEKRGY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein-like 1

Protein Size: 607

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54748_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54748_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 309593
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×