GOPC Antibody - N-terminal region : HRP

GOPC Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56214_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: GOPC plays a role in intracellular protein trafficking and degradation. GOPC may regulate CFTR chloride currents and acid-induced ACCN3 currents by modulating cell surface expression of both channels. GOPC may also regulate the intracellular trafficking of the ADR1B receptor. GOPC may play a role in autophagy. Overexpression of GOPC results in CFTR intracellular retention and degradation in the lysosomes.PIST is a PDZ domain-containing Golgi protein. PDZ domains contain approximately 90 amino acids and bind the extreme C terminus of proteins in a sequence-specific manner.[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GOPC

Key Reference: Wolde,M., (2007) J. Biol. Chem. 282 (11), 8099-8109

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: EVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Golgi-associated PDZ and coiled-coil motif-containing protein

Protein Size: 454

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56214_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56214_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57120
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×