Gpatc2 Antibody - C-terminal region : FITC

Gpatc2 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP57094_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Gpatc2

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: DELRSESDSSSLSSTDAGLFTNDEGRQVFILIVRNFKVRSPSKGKLMSGN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: G patch domain containing 2 EMBL AAH79232.1

Protein Size: 410

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57094_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57094_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 289362
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×