GPD1L Antibody - middle region : Biotin

GPD1L Antibody - middle region : Biotin
Artikelnummer
AVIARP55177_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GPD1L

Key Reference: London,B., (2007) Circulation 116 (20), 2260-2268

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: ELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glycerol-3-phosphate dehydrogenase 1-like protein

Protein Size: 351

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55177_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55177_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23171
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×