GPS1 Antibody - N-terminal region : HRP

GPS1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57999_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene is known to suppress G-protein and mitogen-activated signal transduction in mammalian cells. The encoded protein shares significant similarity with Arabidopsis FUS6, which is a regulator of light-mediated signal transduction in plant cells. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: VQRTFNVDMYEEIHRKLSEATRSSLRELQNAPDAIPESGVEPPALDTAWV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: COP9 signalosome complex subunit 1

Protein Size: 491

Purification: Affinity Purified

Subunit: 1
Mehr Informationen
Artikelnummer AVIARP57999_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57999_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2873
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×