Gpx7 Antibody - C-terminal region : Biotin

Gpx7 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP55329_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Gpx7

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: RTYSVSFPMFSKIAVTGTGAHPAFKYLTQTSGKEPTWNFWKYLVAPDGKV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glutathione peroxidase RuleBase RU000499

Protein Size: 186

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55329_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55329_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 298376
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×