GREM2 Antibody - N-terminal region : Biotin

GREM2 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57635_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene belongs, is characterized by a C-terminal cystine knot with an eight-membered ring. The antagonistic effect of the secreted glycosylated protein encoded by this gene is likely due to its direct binding to BMP proteins. As an antagonist of BMP, this gene may play a role in regulating organogenesis, body patterning, and tissue differentiation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GREM2

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Gremlin-2

Protein Size: 168

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57635_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57635_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 64388
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×