GRK4 Antibody - middle region : Biotin

GRK4 Antibody - middle region : Biotin
Artikelnummer
AVIARP53565_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: GRK4 is a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating its deactivation. GRK4 has been linked to both genetic and acquired hypertension.This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating its deactivation. This gene has been linked to both genetic and acquired hypertension.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GRK4

Key Reference: Staessen,J.A., (er) Hypertension (2008) In press

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: QSRFVVSLAYAYETKDALCLVLTIMNGGDLKFHIYNLGNPGFDEQRAVFY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: G protein-coupled receptor kinase 4

Protein Size: 532

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53565_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53565_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2868
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×