GRK4 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating its deactivation. This gene has been linked to both genetic and acquired hypertension.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GRK4

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: EKVKWEEVDQRIKNDTEEYSEKFSEDAKSICRMLLTKNPSKRLGCRGEGA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: G protein-coupled receptor kinase 4

Protein Size: 546

Purification: Affinity Purified

• Artikelnummer: AVIARP53566_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53566_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2868
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin