GRK5 Antibody - C-terminal region : HRP

GRK5 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP54751_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs).

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human GRK5

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: WGLGCLIYEMIEGQSPFRGRKEKVKREEVDRRVLETEEVYSHKFSEEAKS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: G protein-coupled receptor kinase 5

Protein Size: 485

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54751_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54751_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2869
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×