GSG1 Antibody - C-terminal region : Biotin

GSG1 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP53834_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: GSG1 belongs to the GSG1 family. GSG1 may cause the redistribution of PAPOLB from the cytosol to the endoplasmic reticulum.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GSG1

Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: VLEFKCKHSKSFKENPNCLPHHHQCFPRRLSSAAPTVGPLTSYHQYHNQP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Germ cell-specific gene 1-like protein

Protein Size: 326

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53834_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53834_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 83445
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×