GSG1 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: GSG1 belongs to the GSG1 family. GSG1 may cause the redistribution of PAPOLB from the cytosol to the endoplasmic reticulum.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GSG1

Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: VLEFKCKHSKSFKENPNCLPHHHQCFPRRLSSAAPTVGPLTSYHQYHNQP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Germ cell-specific gene 1-like protein

Protein Size: 326

Purification: Affinity Purified

• Artikelnummer: AVIARP53834_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53834_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 83445
• Wirt: Rabbit
• Konjugat: Conjugated, HRP