GSG1 Antibody - C-terminal region : HRP

GSG1 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP53835_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: GSG1 belongs to the GSG1 family. GSG1 may cause the redistribution of PAPOLB from the cytosol to the endoplasmic reticulum.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GSG1

Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: VGPLTSYHQYHNQPIHSVSEGVDFYSELRNKGFQRGASQELKEAVRSSVE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Germ cell-specific gene 1 protein

Protein Size: 326

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53835_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53835_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rabbit
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 83445
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×