GSG1 Antibody - N-terminal region : FITC

GSG1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP53801_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GSG1 belongs to the GSG1 family. GSG1 may cause the redistribution of PAPOLB from the cytosol to the endoplasmic reticulum.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GSG1

Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: NYWFVGTQKVPKPLCEKGLAAKCFDMPVSLDGDTNTSTQEVVQYNWETGD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Germ cell-specific gene 1 protein

Protein Size: 362

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53801_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53801_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 83445
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×