GSG1L Antibody - N-terminal region : Biotin

GSG1L Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54557_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: As a component of the inner core of AMPAR complex, GSG1L modifies AMPA receptor (AMPAR) gating.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GSG1L

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: NFHTGIWYSCEEELSGLGEKCRSFIDLAPASEKGVLWLSVVSEVLYILLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Germ cell-specific gene 1-like protein

Protein Size: 280

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54557_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54557_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 146395
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×