GSG1L Antibody - N-terminal region : HRP

GSG1L Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54557_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: As a component of the inner core of AMPAR complex, GSG1L modifies AMPA receptor (AMPAR) gating.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GSG1L

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: NFHTGIWYSCEEELSGLGEKCRSFIDLAPASEKGVLWLSVVSEVLYILLL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Germ cell-specific gene 1-like protein

Protein Size: 280

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54557_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54557_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 146395
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×