GSN Antibody - C-terminal region : HRP

GSN Antibody - C-terminal region : HRP
Artikelnummer
AVIARP54299_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: GSN binds to the 'plus' ends of actin monomers and filaments to prevent monomer exchange. It is a calcium-regulated protein, which functions in both assembly and disassembly of actin filaments. Defects in the gene encoding GSN are a cause of familial amyloidosis Finnish type (FAF).The protein encoded by this gene binds to the 'plus' ends of actin monomers and filaments to prevent monomer exchange. The encoded calcium-regulated protein functions in both assembly and disassembly of actin filaments. Defects in this gene are a cause of familial amyloidosis Finnish type (FAF). Multiple transcript variants encoding several different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GSN

Key Reference: Shokouhi,G. Nephrol. Dial. Transplant. 23 (3), 1071 (2008)

Molecular Weight: 83kDa

Peptide Sequence: Synthetic peptide located within the following region: KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Gelsolin

Protein Size: 782

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54299_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54299_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 2934
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×