GSR Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GSR belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. It maintains high levels of reduced glutathione in the cytosol. Both glutathione and glutathione reductase are inducible by D3T, and that upregulation of GSH biosynthesis underlies D3T-mediated cytoprotection against ROS/RNS-elicited injury to human vascular smooth muscle cells.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GSR

Key Reference: Senturk,M., (2008) J Enzyme Inhib Med Chem 23 (1), 144-148

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glutathione reductase, mitochondrial

Protein Size: 522

Purification: Affinity Purified

• Artikelnummer: AVIARP54344_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54344_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 2936
• Wirt: Rabbit
• Konjugat: Conjugated, FITC