GSS Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Glutathione is important for a variety of biological functions, including protection of cells from oxidative damage by free radicals, detoxification of xenobiotics, and membrane transport. The protein encoded by this gene functions as a homodimer to catalyze the second step of glutathione biosynthesis, which is the ATP-dependent conversion of gamma-L-glutamyl-L-cysteine to glutathione. Defects in this gene are a cause of glutathione synthetase deficiency.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GSHB

Key Reference: N/A

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: FRDGYMPRQYSLQNWEARLLLERSHAAKCPDIATQLAGTKKVQQELSRPG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: glutathione synthetase

Protein Size: 474

Purification: Affinity purified

• Artikelnummer: AVIARP54302_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54302_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2937
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin