GSS Antibody - N-terminal region : FITC

GSS Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54301_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Glutathione is important for a variety of biological functions, including protection of cells from oxidative damage by free radicals, detoxification of xenobiotics, and membrane transport. The protein encoded by this gene functions as a homodimer to catalyze the second step of glutathione biosynthesis, which is the ATP-dependent conversion of gamma-L-glutamyl-L-cysteine to glutathione. Defects in this gene are a cause of glutathione synthetase deficiency.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GSHB

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: QIEINTISASFGGLASRTPAVHRHVLSVLSKTKEAGKILSNNPSKGLALG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: glutathione synthetase

Protein Size: 474

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP54301_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54301_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2937
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×