GSS Antibody - N-terminal region : HRP

GSS Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54301_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Glutathione is important for a variety of biological functions, including protection of cells from oxidative damage by free radicals, detoxification of xenobiotics, and membrane transport. The protein encoded by this gene functions as a homodimer to catalyze the second step of glutathione biosynthesis, which is the ATP-dependent conversion of gamma-L-glutamyl-L-cysteine to glutathione. Defects in this gene are a cause of glutathione synthetase deficiency.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GSHB

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: QIEINTISASFGGLASRTPAVHRHVLSVLSKTKEAGKILSNNPSKGLALG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: glutathione synthetase

Protein Size: 474

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP54301_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54301_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2937
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×