GTF2A1 Antibody - N-terminal region : FITC

GTF2A1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58154_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GTF2A1 belongs to the TFIIA subunit 1 family. It is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. This protein induces a conformational change within the TBP/TATA complex that enhances its stability under both in vitro and physiological salt conditions.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GTF2A1

Key Reference: Hieb,A.R., (2007) J. Mol. Biol. 372 (3), 619-632

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: ANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transcription initiation factor IIA subunit 1

Protein Size: 376

Purification: Affinity Purified

Subunit: 1
Mehr Informationen
Artikelnummer AVIARP58154_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58154_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2957
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×