GTF2A1L Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involve the effects of TFIIA on the interaction between TATA-binding protein (TBP) and DNA. This gene encodes a germ cell-specific counterpart of the large (alpha/beta) subunit of general transcription factor TFIIA that is able to stabilize the binding of TBP to DNA and may be uniquely important to testis biology.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GTF2A1L

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: EFLGNIDGGDLKVPEEEADSISNEDSATNSSDNEDPQVNIVEEDPLNSGD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 453

Purification: Affinity Purified

• Artikelnummer: AVIARP53837_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53837_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 11036
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin