Gtf2h5 Antibody - N-terminal region : Biotin

Gtf2h5 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55987_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Gtf2h5 is a component of the TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. It is necessary for the stability of the TFIIH complex and for the presence of normal levels of TFIIH in the cell.

Molecular Weight: 8kDa

Peptide Sequence: Synthetic peptide located within the following region: QFLLYLDEANALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: General transcription factor IIH subunit 5

Protein Size: 71

Purification: Affinity Purified

Subunit: 5
Mehr Informationen
Artikelnummer AVIARP55987_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55987_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 66467
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×