Gtf2h5 Antibody - N-terminal region : HRP

Gtf2h5 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55987_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Gtf2h5 is a component of the TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. It is necessary for the stability of the TFIIH complex and for the presence of normal levels of TFIIH in the cell.

Molecular Weight: 8kDa

Peptide Sequence: Synthetic peptide located within the following region: QFLLYLDEANALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: General transcription factor IIH subunit 5

Protein Size: 71

Purification: Affinity Purified

Subunit: 5
Mehr Informationen
Artikelnummer AVIARP55987_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55987_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 66467
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×