Gtpbp4 Antibody - C-terminal region : FITC

Gtpbp4 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP54883_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Gtpbp4 may be involved in GTP-mediated signaling associated with cell proliferation and renal function.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Gtpbp4

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: CSKTPRDVSGLRDVKMVKKAKTMMKKAQKKMNRLGKKGEADRHVFDMKPK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nucleolar GTP-binding protein 1 PIRNR PIRNR038919

Protein Size: 636

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54883_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54883_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 114300
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×