GUCA1A Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GUCA1A(GCAP1) plays a role in the recovery of retinal photoreceptors from photobleaching. In the recovery phase, the phototransduction messeneger cGMP is replenished by retinal guanylyl cyclase-1 (GC1). GC1 is activated by decreasing Ca(2+) concentrations following photobleaching. The protein mediates the sensitivity of GC1 to Ca(2+) concentrations. GCAP1 promotes activity of GC1 at low Ca(2+) concentrations and inhibits GC1 activity at high Ca(2+) concentrations. Mutations in this gene cause autosomal dominant cone dystrophy (COD3); a disease characterized by reduced visual acuity associated with progressive loss of color vision. Mutations in this gene prohibit the inactivation of RetGC1 at high Ca(2+) concentrations; causing the constitutive activation of RetGC1 and, presumably, increased cell death. This gene is expressed in retina and spermatagonia.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GUCA1A

Key Reference: Michaelides,M., (2005) Ophthalmology 112 (8), 1442-1447

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: LYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanylyl cyclase-activating protein 1

Protein Size: 201

Purification: Affinity Purified

• Artikelnummer: AVIARP54309_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54309_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2978
• Wirt: Rabbit
• Konjugat: Conjugated, FITC