GZMA Antibody - C-terminal region : FITC

GZMA Antibody - C-terminal region : FITC
Artikelnummer
AVIARP54794_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GZMA

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: LRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Granzyme A

Protein Size: 262

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54794_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54794_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Dog (Canine), Guinea Pig
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3001
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×