H2AFY Antibody - N-terminal region : Biotin

H2AFY Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58282_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core hi

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human H2AFY

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Core histone macro-H2A.1

Protein Size: 369

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58282_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58282_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 9555
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×