HADH Antibody - middle region : HRP

HADH Antibody - middle region : HRP
Artikelnummer
AVIARP54764_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: HADH functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HADH

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: SSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial

Protein Size: 314

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54764_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54764_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3033
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×