HAGH Antibody - C-terminal region : Biotin

HAGH Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP54515_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: HAGH belongs to the metallo-beta-lactamase superfamily, glyoxalase II family. It is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate.The enzyme encoded by this gene is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HAGH

Key Reference: Xu,Y. (2006) J. Biol. Chem. 281 (36), 26702-26713

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: STLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAVRREKDQFKMPRD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Hydroxyacylglutathione hydrolase, mitochondrial

Protein Size: 260

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54515_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54515_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3029
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×