HAPLN2 Antibody - middle region : FITC

HAPLN2 Antibody - middle region : FITC
Artikelnummer
AVIARP57560_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: HAPLN2 mediates a firm binding of versican V2 to hyaluronic acid.HAPLN2 may play a pivotal role in the formation of the hyaluronan-associated matrix in the central nervous system (CNS) which facilitates neuronal conduction and general structural stabilization. HAPLN2 binds to hyaluronic acid.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HAPLN2

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: LDQCDGGWLADGSVRFPITTPRPRCGGLPDPGVRSFGFPRPQQAAYGTYC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Hyaluronan and proteoglycan link protein 2

Protein Size: 340

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57560_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57560_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 60484
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×