HAPLN2 Antibody - middle region : HRP

HAPLN2 Antibody - middle region : HRP
Artikelnummer
AVIARP57560_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: HAPLN2 mediates a firm binding of versican V2 to hyaluronic acid.HAPLN2 may play a pivotal role in the formation of the hyaluronan-associated matrix in the central nervous system (CNS) which facilitates neuronal conduction and general structural stabilization. HAPLN2 binds to hyaluronic acid.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HAPLN2

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: LDQCDGGWLADGSVRFPITTPRPRCGGLPDPGVRSFGFPRPQQAAYGTYC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Hyaluronan and proteoglycan link protein 2

Protein Size: 340

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57560_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57560_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 60484
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×