HCFC1R1 Antibody - middle region : Biotin

HCFC1R1 Antibody - middle region : Biotin
Artikelnummer
AVIARP56149_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: HCFC1R1 regulates HCFC1 activity by modulating its subcellular localization. Overexpression of HCFC1R1 leads to accumulation of HCFC1 in the cytoplasm. HCFC1R1-mediated export may provide the pool of cytoplasmic HCFC1 required for import of virion-derived VP16 into the nucleus.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HCFC1R1

Key Reference: Mahajan,S.S., (2002) J. Biol. Chem. 277 (46), 44292-44299

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: LRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Host cell factor C1 regulator 1

Protein Size: 138

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56149_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56149_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54985
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×