HCV1a (D168V), FLAG-His-tags Recombinant

HCV1a (D168V), FLAG-His-tags Recombinant
Artikelnummer
BPS80103
Verpackungseinheit
20 µg
Hersteller
BPS Bioscience

Verfügbarkeit: wird geladen...
Preis wird geladen...
Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 21-32 of NS4A, linker (4 a.a.) and a.a. 3-181 of NS3

Amino Acid Sequence: MDYKDDDDKHHHHHHGCVVIVGRIVLSGSGSITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVVFIPVENLETTMRS

Application: Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.

Description: Fusion protein corresponding to the serine protease NS3 (a.a. 3-181) and cofactor NS4A (a.a. 21-32) from Hepatitis C virus genotype 1a (GenBank Accession No. NC_004102) with Asp-to-Val mutation on a.a. 168, an N-terminal FLAG-His tag, and a 4 a.a. linker, MW = 22.4 kDa, expressed in an E. coli expression system.

Format: Aqueous buffer solution

Formulation: 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04% Tween-20, 20% glycerol, and 250 mM imidazole.

Genbank: NC_004102

Storage Stability: At least 6 months at -80°C.

Tags: N-terminal FLAG-His-tags

Uniprot: P27958

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Lin, C., et al., Hepatitis C Virus. Norfolk (UK): Horizon Bioscience; 2006. Chapter 6.
2. Prabhu, R., et al., Exp Mol Pathol. 2004 Jun;76(3):242-52.
Mehr Informationen
Artikelnummer BPS80103
Hersteller BPS Bioscience
Hersteller Artikelnummer 80103
Verpackungseinheit 20 µg
Mengeneinheit STK
Produktinformation (PDF) Download
MSDS (PDF)
×