HCV1b (R155K), FLAG-His-tags Recombinant

HCV1b (R155K), FLAG-His-tags Recombinant
Artikelnummer
BPS80109
Verpackungseinheit
20 µg
Hersteller
BPS Bioscience

Verfügbarkeit: wird geladen...
Preis wird geladen...
Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 21-32 of NS4A, linker (4 a.a.) and a.a. 3-181 of NS3

Amino Acid Sequence: MDYKDDDDKHHHHHHGSVVIVGRIILSGSGSITAYSQQTRGVLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCINGVCWTVYHGAGSKTLAGPKGPITQMYTNVDLDLVGWQAPPGARSMTPCSCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGVFKAAVCTRGVAKAVDFIPVESMETTMRS

Application: Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.

Assay Conditions: Assay was performed in 100 μl HCV assay buffer containing 50 mM Tris, pH 7.4, 150 mM NaCl, 5 mM DTT, 10% glycerol, and 5 ?M fluorescently labeled HCV substrate peptide. Reaction was monitored at room temperature for 20 min. continuously at ex350/em500.

Description: Fusion protein corresponding to the serine protease NS3 (a.a. 3-181) and cofactor NS4A (a.a. 21-32) from Hepatitis C virus genotype 1b (GenBank Accession No. AF054247) withArg-to-Lys mutation on a.a. 155, an N-terminal FLAG-His tag, and a 4 a.a. linker, MW = 22.3 kDa, expressed in an E. coli expression system.

Format: Aqueous buffer solution

Formulation: 40 mM Tris-HCl, pH 8.0, 400 mM NaCl, 0.2% Triton X-100, 10 mM beta-mercaptoethanol, 100 µg/mL FLAG peptide, and 30% glycerol.

Genbank: AF054247

Storage Stability: At least 6 months at -80°C.

Tags: N-terminal FLAG-His-tags

Uniprot: O92972

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Lin, C., et al., Hepatitis C Viruse. Norfolk (UK): Horizon Bioscience; 2006. Chapter 6.
2. Lang Kuhs, K.A., et al., Mol. Ther. 2012 May;20(3):669-678.
3. Massariol, MJ., et al., Biochem Biophys Res Commun. 2010 Jan 1;391(1):692-697.
Mehr Informationen
Artikelnummer BPS80109
Hersteller BPS Bioscience
Hersteller Artikelnummer 80109
Verpackungseinheit 20 µg
Mengeneinheit STK
Produktinformation (PDF) Download
MSDS (PDF)
×