HDDC3 Antibody - middle region : Biotin

HDDC3 Antibody - middle region : Biotin
Artikelnummer
AVIARP55898_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HDDC3

Key Reference: Zody,M.C., (2006) Nature 440 (7084), 671-675

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: TDDKTLPKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEVKI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1

Protein Size: 140

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55898_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55898_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 374659
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×